PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00111.1_g00052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 167aa    MW: 18542.1 Da    PI: 9.8781
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00111.1_g00052.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.4e-3852110260
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                              ++++++cprC+s++tkfCy+nny+ +qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k 
  Rsa1.0_00111.1_g00052.1  52 PDRIIACPRCKSMETKFCYFNNYNANQPRHFCKSCHRYWTAGGALRNVPVGAGRRKSKP 110
                              67889***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2851109IPR003851Zinc finger, Dof-type
PfamPF027013.5E-3255109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.04356110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MATQNSQGIK LFGKTIAFNV NITQTIKSEE EKPPSDPVAR SSSSEPTVEK RPDRIIACPR  60
CKSMETKFCY FNNYNANQPR HFCKSCHRYW TAGGALRNVP VGAGRRKSKP LGRVVVGMLG  120
DGNEVHHVEL INGLLAHELH SAAAARGGFR HDFSLKRLRC FSDSEPC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635531.11e-109PREDICTED: cyclic dof factor 4-like
RefseqXP_013719282.11e-109PREDICTED: cyclic dof factor 4-like
SwissprotO229672e-91CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A078HH541e-110A0A078HH54_BRANA; BnaA04g19980D protein
STRINGBra021895.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.16e-85Dof family protein